BCKDHA Antibody
| Name | BCKDHA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79616 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human BCKDHAThe immunogen for this antibody is BCKDHA. Peptide sequence NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | BCKDHA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: BCKDHA Antibody [NBP1-79616] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28167_BCKDHA-Antibody-Western-Blot-NBP1-79616-img0002.jpg)
Western Blot: BCKDHA Antibody [NBP1-79616] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: BCKDHA Antibody [NBP1-79616] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic in alveolar type I & II cells](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28168_BCKDHA-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-79616-img0006.jpg)
Immunocytochemistry/Immunofluorescence: BCKDHA Antibody [NBP1-79616] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasmic in alveolar type I & II cells
![Western Blot: BCKDHA Antibody [NBP1-79616] - Human Adult Placenta.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28169_BCKDHA-Antibody-Western-Blot-NBP1-79616-img0003.jpg)
Western Blot: BCKDHA Antibody [NBP1-79616] - Human Adult Placenta.