Name | sFRP-3/FRZB Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-79552 |
Prices | $139.00, $369.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptide directed towards the middle region of human FRZBThe immunogen for this antibody is FRZB. Peptide sequence VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | FRZB |
Conjugate | Unconjugated |
Supplier Page | Shop |