sFRP-3/FRZB Antibody

Name sFRP-3/FRZB Antibody
Supplier Novus Biologicals
Catalog NBP1-79552
Prices $139.00, $369.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human FRZBThe immunogen for this antibody is FRZB. Peptide sequence VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FRZB
Conjugate Unconjugated
Supplier Page Shop

Product images