POPDC3 Antibody

Name POPDC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59476
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to POPDC3(popeye domain containing 3) The peptide sequence was selected from the C terminal of POPDC3. Peptide sequence YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene POPDC3
Conjugate Unconjugated
Supplier Page Shop

Product images