IFIT3 Antibody
| Name | IFIT3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56632 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to IFIT3(interferon-induced protein with tetratricopeptide repeats 3) The peptide sequence was selected from the N terminal of IFIT3. Peptide sequence ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IFIT3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: IFIT3 Antibody [NBP1-56632] - HepG2 tissue lysate at a concentration of 0.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24729_IFIT3-Antibody-Western-Blot-NBP1-56632-img0001.jpg)
Western Blot: IFIT3 Antibody [NBP1-56632] - HepG2 tissue lysate at a concentration of 0.25ug/ml.
![Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP1-56632] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24730_IFIT3-Antibody-Immunohistochemistry-Paraffin-NBP1-56632-img0002.jpg)
Immunohistochemistry-Paraffin: IFIT3 Antibody [NBP1-56632] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.