TCF19 Antibody (6D8)

• Supplier: Novus Biologicals
• Catalog: H00006941-M01
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1 Kappa
• Clone: 6D8
• Applications: WB ELISA ICC/IF IHC-P Gene Silencing
• Species Reactivities: Human
• Antigen: TCF19 (NP_009040, 17 a.a. - 102 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL
• Purity/Format: Ascites
• Description: Mouse Monoclonal
• Gene: TCF19
• Conjugate: Unconjugated

Product images

Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - TCF19 monoclonal antibody (M01), clone 6D8 Analysis of TCF19 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on HeLa cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.

Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi ( Cat # H00006941-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody (M01), clone 6D8 (Cat # H00006941-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: TCF19 Antibody (6D8) [H00006941-M01] - Analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody (M01), clone 6D8.Lane 1: TCF19 transfected lysate(37.2 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: TCF19 Antibody (6D8) [H00006941-M01] - Detection limit for recombinant GST tagged TCF19 is approximately 0.1ng/ml as a capture antibody.