HN1 Antibody
| Name | HN1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32492 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HN1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MTRNR2L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HN1 Antibody [NBP2-32492] - Analysis in human cell line PC-3.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22202_HN1-Antibody-Western-Blot-NBP2-32492-img0010.jpg)
Western Blot: HN1 Antibody [NBP2-32492] - Analysis in human cell line PC-3.
![Immunocytochemistry/Immunofluorescence: HN1 Antibody [NBP2-32492] - Immunofluorescent staining of human cell line A549 shows localization to nucleus & nuclear membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22203_HN1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32492-img0013.jpg)
Immunocytochemistry/Immunofluorescence: HN1 Antibody [NBP2-32492] - Immunofluorescent staining of human cell line A549 shows localization to nucleus & nuclear membrane.
![Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of liver cancer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22204_HN1-Antibody-Immunohistochemistry-NBP2-32492-img0003.jpg)
Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of liver cancer.
![Immunocytochemistry/Immunofluorescence: HN1 Antibody [NBP2-32492] - Staining of human cell line A549 shows positivity in nucleus and nuclear membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22205_HN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32492-img0012.jpg)
Immunocytochemistry/Immunofluorescence: HN1 Antibody [NBP2-32492] - Staining of human cell line A549 shows positivity in nucleus and nuclear membrane.
![Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22206_HN1-Antibody-Immunohistochemistry-NBP2-32492-img0001.jpg)
Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
![Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of cerebellum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22207_HN1-Antibody-Immunohistochemistry-NBP2-32492-img0002.jpg)
Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of cerebellum.