GPR171 Antibody
| Name | GPR171 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32359 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LSKAFRSKVTETFASPKETKAQKEKLRCENNA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GPR171 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GPR171 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GPR171 Antibody [NBP2-32359] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6748_GPR171-Antibody-Western-Blot-NBP2-32359-img0004.jpg)
Western Blot: GPR171 Antibody [NBP2-32359] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunohistochemistry-Paraffin: GPR171 Antibody [NBP2-32359] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6749_GPR171-Antibody-Immunohistochemistry-Paraffin-NBP2-32359-img0005.jpg)
Immunohistochemistry-Paraffin: GPR171 Antibody [NBP2-32359] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.