espin Antibody
| Name | espin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90588 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | espin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ESPN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: espin Antibody [NBP1-90588] - Analysis in human cell line SK-BR-3.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/4135_espin-Antibody-Western-Blot-NBP1-90588-img0011.jpg)
Western Blot: espin Antibody [NBP1-90588] - Analysis in human cell line SK-BR-3.
![Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/4136_espin-Antibody-Immunohistochemistry-Paraffin-NBP1-90588-img0010.jpg)
Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
![Western Blot: espin Antibody [NBP1-90588] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/4137_espin%2520Antibody-Western%2520Blot-NBP1-90588-img0012.jpg)
Western Blot: espin Antibody [NBP1-90588] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
![Simple Western: espin Antibody [NBP1-90588] - Simple Western lane view shows a specific band for ESPN in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/4138_espin-Antibody-Simple-Western-NBP1-90588-img0008.jpg)
Simple Western: espin Antibody [NBP1-90588] - Simple Western lane view shows a specific band for ESPN in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: espin Antibody [NBP1-90588] - Electropherogram image(s) of corresponding Simple Western lane view. espin antibody was used at 1:20 dilution on RT-4 lysate(s).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/4139_espin-Antibody-Simple-Western-NBP1-90588-img0009.jpg)
Simple Western: espin Antibody [NBP1-90588] - Electropherogram image(s) of corresponding Simple Western lane view. espin antibody was used at 1:20 dilution on RT-4 lysate(s).