TOM70 Antibody
| Name | TOM70 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87863 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TOM70 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TOMM70A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TOM70 Antibody [NBP1-87863] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3586_TOM70-Antibody-Western-Blot-NBP1-87863-img0007.jpg)
Western Blot: TOM70 Antibody [NBP1-87863] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: TOM70 Antibody [NBP1-87863] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3587_TOM70%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87863-img0011.jpg)
Immunocytochemistry/Immunofluorescence: TOM70 Antibody [NBP1-87863] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
![Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells, cells in the granular and molecular layer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3588_TOM70-Antibody-Immunohistochemistry-Paraffin-NBP1-87863-img0001.jpg)
Immunohistochemistry-Paraffin: TOM70 Antibody [NBP1-87863] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells, cells in the granular and molecular layer.
![Western Blot: TOM70 Antibody [NBP1-87863] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3589_TOM70-Antibody-Western-Blot-NBP1-87863-img0008.jpg)
Western Blot: TOM70 Antibody [NBP1-87863] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
![Simple Western: TOM70 Antibody [NBP1-87863] - Detection of TOM70 in purified mitochondrial (lanes 1-3 at 1:100, 1:50 and 1:25 dilutions, respectively) and cytosol (lane 4 at 1:25 dilution) preparations of SVG-A cells. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/3590_TOM70-Antibody-Simple-Western-NBP1-87863-img0010.jpg)
Simple Western: TOM70 Antibody [NBP1-87863] - Detection of TOM70 in purified mitochondrial (lanes 1-3 at 1:100, 1:50 and 1:25 dilutions, respectively) and cytosol (lane 4 at 1:25 dilution) preparations of SVG-A cells. Image from verified customer review.