PGRMC1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-83220
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB Simple Western ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PGRMC1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PGRMC1
• Conjugate: Unconjugated

Product images

Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: PGRMC1 Antibody [NBP1-83220] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & endoplasmic reticulum.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Western Blot: PGRMC1 Antibody [NBP1-83220] - Analysis in human cell line HEK 293.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular and stromal cells.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human breast cancer shows strong cytoplasmic positivity in tumor cells.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: PGRMC1 Antibody [NBP1-83220] - Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Simple Western: PGRMC1 Antibody [NBP1-83220] - Simple Western lane view shows a specific band for PGRMC1 in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: PGRMC1 Antibody [NBP1-83220] - Electropherogram image(s) of corresponding Simple Western lane view. PGRMC1 antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).