ATP6V0A2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59069
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ATP6V0A2(ATPase, H+ transporting, lysosomal V0 subunit a2) The peptide sequence was selected from the N terminal of ATP6V0A2. Peptide sequence INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ATP6V0A2
• Conjugate: Unconjugated