| Name | SLC26A5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59791 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC26A5(solute carrier family 26, member 5 (prestin)) The peptide sequence was selected from the middle region of SLC26A5. Peptide sequence FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC26A5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |