GNB1L Antibody
| Name | GNB1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58342 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GNB1L (guanine nucleotide binding protein (G protein), beta polypeptide 1-like) The peptide sequence was selected from the C terminal of GNB1L. Peptide sequence RVFHWRTMQPLAVLAFHSAAVQCVAFTADGLLAAGSKDQRI |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | GNB1L |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GNB1L Antibody [NBP1-58342] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19978_GNB1L-Antibody-Western-Blot-NBP1-58342-img0006.jpg)
Western Blot: GNB1L Antibody [NBP1-58342] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%
![Immunohistochemistry-Paraffin: GNB1L Antibody [NBP1-58342] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19979_GNB1L-Antibody-Immunohistochemistry-Paraffin-NBP1-58342-img0003.jpg)
Immunohistochemistry-Paraffin: GNB1L Antibody [NBP1-58342] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.
![Western Blot: GNB1L Antibody [NBP1-58342] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19980_GNB1L-Antibody-Western-Blot-NBP1-58342-img0004.jpg)
Western Blot: GNB1L Antibody [NBP1-58342] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.
![Immunohistochemistry-Paraffin: GNB1L Antibody [NBP1-58342] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19981_GNB1L-Antibody-Immunohistochemistry-Paraffin-NBP1-58342-img0002.jpg)
Immunohistochemistry-Paraffin: GNB1L Antibody [NBP1-58342] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.