GPSM2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-53125
• Prices: $369.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to GPSM2(G-protein signaling modulator 2 (AGS3-like, C. elegans)) The peptide sequence was selected from the N terminal of GPSM2 (NP_037428). Peptide sequence YFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEA.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: GPSM2
• Conjugate: Unconjugated

Product images

Western Blot: GPSM2 Antibody [NBP1-53125] - Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0 ug/ml

Immunocytochemistry/Immunofluorescence: GPSM2 Antibody [NBP1-53125] - Human cell lines.

Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Paraffin Embedded Tissue: Human Liver Antibody Concentration: 5 ug/ml

Western Blot: GPSM2 Antibody [NBP1-53125] - Human Fetal Liver Lysate, concentration 1ug/ml.

Immunohistochemistry-Paraffin: GPSM2 Antibody [NBP1-53125] - Human Placenta.

Immunohistochemistry: GPSM2 Antibody [NBP1-53125] - Analysis of human liver after heat-induced Antigen retrieval. Antibody concentration 5 ug/ml.