SQLE Antibody
| Name | SQLE Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80502 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Sheep |
| Antigen | Synthetic peptide directed towards the C terminal of human SQLE. Peptide sequence KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SQLE |
| Supplier Page | Shop |
Product images
![Western Blot: SQLE Antibody [NBP1-80502] - 721_B Cell Lysate 0.25ug/ml Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/23697_SQLE-Antibody-Western-Blot-NBP1-80502-img0001.jpg)
Western Blot: SQLE Antibody [NBP1-80502] - 721_B Cell Lysate 0.25ug/ml Gel Concentration 12%
![Immunohistochemistry-Paraffin: SQLE Antibody [NBP1-80502] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/23699_SQLE-Antibody-Immunohistochemistry-Paraffin-NBP1-80502-img0003.jpg)
Immunohistochemistry-Paraffin: SQLE Antibody [NBP1-80502] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.
![Immunocytochemistry/Immunofluorescence: SQLE Antibody [NBP1-80502] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic; Primary Antibody Concentration: 1:100](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/20842_SQLE-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80502-img0005.jpg)
Immunocytochemistry/Immunofluorescence: SQLE Antibody [NBP1-80502] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic; Primary Antibody Concentration: 1:100