HNRPA3 Antibody

Name HNRPA3 Antibody
Supplier Novus Biologicals
Catalog NBP1-80486
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human HNRPA3. Peptide sequence MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene HNRNPA3
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.