RPS16 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-80025
• Prices: $299.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human RPS16. Peptide sequence SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: RPS16
• Conjugate: Unconjugated

Product images

Western Blot: RPS16 Antibody [NBP1-80025] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 10-20%

Immunohistochemistry: RPS16 Antibody [NBP1-80025] - Human alveolar cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Western Blot: RPS16 Antibody [NBP1-80025] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.

Western Blot: RPS16 Antibody [NBP1-80025] - Sample Tissue: Jurkat cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5ug/ml, Peptide Concentration: 4.0ug/ml, Lysate Quantity: 25ug/lane

Immunohistochemistry-Paraffin: RPS16 Antibody [NBP1-80025] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.