ACAA1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55156
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: Synthetic peptides corresponding to ACAA1(acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiolase)) The peptide sequence was selected from the N terminal of ACAA1. Peptide sequence ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ACAA1
• Conjugate: Unconjugated

Product images

Western Blot: ACAA1 Antibody [NBP1-55156] - Rat purified peroxisomes (33ug) at 1:1000.

Immunohistochemistry: ACAA1 Antibody [NBP1-55156] - Human Liver Tissue Observed Staining: Cytoplasm in granules of hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec.

Western Blot: ACAA1 Antibody [NBP1-55156] - Human Fetal Brain tissue lysate at a concentration of 1ug/ml.

Western Blot: ACAA1 Antibody [NBP1-55156] - Human Liver cell lysate at 1:1000.

Immunohistochemistry-Paraffin: ACAA1 Antibody [NBP1-55156] - Human Liver cell lysate tissue.