Glycogenin 1 Antibody (3B5)
| Name | Glycogenin 1 Antibody (3B5) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00002992-M07 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3B5 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | GYG1 (NP_004121, 1 a.a. - 73 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | GYG1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in HepG2 (Cat # L019V1).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10707_Glycogenin-1-Antibody-(3B5)-Western-Blot-H00002992-M07-img0007.jpg)
Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in HepG2 (Cat # L019V1).
![Immunohistochemistry-Paraffin: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of monoclonal antibody to GYG1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10708_Glycogenin-1-Antibody-(3B5)-Immunohistochemistry-Paraffin-H00002992-M07-img0005.jpg)
Immunohistochemistry-Paraffin: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of monoclonal antibody to GYG1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml
![Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in PC-12 (Cat # L012V1).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10709_Glycogenin-1-Antibody-(3B5)-Western-Blot-H00002992-M07-img0006.jpg)
Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in PC-12 (Cat # L012V1).
![Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in transfected 293T cell line by GYG1 monoclonal antibody (M07), clone 3B5. Lane 1: GYG1 transfected lysatE (37.5 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10710_Glycogenin%25201%2520Antibody%2520(3B5)-Western%2520Blot-H00002992-M07-img0008.jpg)
Western Blot: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Analysis of GYG1 expression in transfected 293T cell line by GYG1 monoclonal antibody (M07), clone 3B5. Lane 1: GYG1 transfected lysatE (37.5 KDa). Lane 2: Non-transfected lysate.
![ELISA: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Detection limit for recombinant GST tagged GYG1 is approximately 0.03ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/10711_Glycogenin-1-Antibody-(3B5)-ELISA-H00002992-M07-img0004.jpg)
ELISA: Glycogenin 1 Antibody (3B5) [H00002992-M07] - Detection limit for recombinant GST tagged GYG1 is approximately 0.03ng/ml as a capture antibody.