DDX3Y Antibody (2D7)
| Name | DDX3Y Antibody (2D7) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00008653-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 2D7 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | DDX3Y (NP_004651, 1 a.a. - 80 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | DDX3Y |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DDX3Y Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in NIH/3T3.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/18306_DDX3Y-Antibody-(2D7)-Western-Blot-H00008653-M01-img0011.jpg)
Western Blot: DDX3Y Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in NIH/3T3.
![Immunohistochemistry-Paraffin: DDX3Y Antibody (2D7) [H00008653-M01] - Analysis of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/18307_DDX3Y-Antibody-(2D7)-Immunohistochemistry-Paraffin-H00008653-M01-img0007.jpg)
Immunohistochemistry-Paraffin: DDX3Y Antibody (2D7) [H00008653-M01] - Analysis of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
![Western Blot: DDX3Y Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7 Analysis of DDX3Y expression in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/18308_DDX3Y-Antibody-(2D7)-Western-Blot-H00008653-M01-img0009.jpg)
Western Blot: DDX3Y Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7 Analysis of DDX3Y expression in HeLa.
![Western Blot: DDX3Y Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in Raw 264.7.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/18309_DDX3Y-Antibody-(2D7)-Western-Blot-H00008653-M01-img0010.jpg)
Western Blot: DDX3Y Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in Raw 264.7.
![Western Blot: DDX3Y Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in mouse testis.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/18310_DDX3Y%2520Antibody%2520(2D7)-Western%2520Blot-H00008653-M01-img0012.jpg)
Western Blot: DDX3Y Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in mouse testis.
![Sandwich ELISA: DDX3Y Antibody (2D7) [H00008653-M01] - Detection limit for recombinant GST tagged DDX3Y is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/18311_DDX3Y-Antibody-(2D7)-Sandwich-ELISA-H00008653-M01-img0008.jpg)
Sandwich ELISA: DDX3Y Antibody (2D7) [H00008653-M01] - Detection limit for recombinant GST tagged DDX3Y is approximately 0.1ng/ml as a capture antibody.