RG9MTD1 Antibody
| Name | RG9MTD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83654 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P IP |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RG9MTD1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TRMT10C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RG9MTD1 Antibody [NBP1-83654] - Analysis in human cell line SCLC-21H.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28113_RG9MTD1-Antibody-Western-Blot-NBP1-83654-img0006.jpg)
Western Blot: RG9MTD1 Antibody [NBP1-83654] - Analysis in human cell line SCLC-21H.
![Immunocytochemistry/Immunofluorescence: RG9MTD1 Antibody [NBP1-83654] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28114_RG9MTD1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83654-img0008.jpg)
Immunocytochemistry/Immunofluorescence: RG9MTD1 Antibody [NBP1-83654] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
![Immunohistochemistry-Paraffin: RG9MTD1 Antibody [NBP1-83654] - Staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/28115_RG9MTD1-Antibody-Immunohistochemistry-Paraffin-NBP1-83654-img0007.jpg)
Immunohistochemistry-Paraffin: RG9MTD1 Antibody [NBP1-83654] - Staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.