PLA2G12B Antibody

• Supplier: Novus Biologicals
• Catalog: NBP2-31685
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against a recombinant protein corresponding to amino acids: DTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESM
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PLA2G12B Protein
• Description: Rabbit Polyclonal
• Gene: PLA2G12B
• Conjugate: Unconjugated

Product images

Western Blot: PLA2G12B Antibody [NBP2-31685] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue

Immunocytochemistry/Immunofluorescence: PLA2G12B Antibody [NBP2-31685] - Staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: PLA2G12B Antibody [NBP2-31685] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.