SHMT2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-80755
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:GQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEAL
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SHMT2 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SHMT2
• Conjugate: Unconjugated

Product images

Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: SHMT2 Antibody [NBP1-80755] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & microtubules.

Immunohistochemistry-Paraffin: SHMT2 Antibody [NBP1-80755] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.

Western Blot: SHMT2 Antibody [NBP1-80755] - Analysis in human cell line SK-MEL-30.