PSMC1 Antibody
| Name | PSMC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80959 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENVLYKKQEGTPE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PSMC1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PSMC1 |
| Supplier Page | Shop |
Product images
![Western Blot: PSMC1 Antibody [NBP1-80959] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells); Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/27951_PSMC1-Antibody-Western-Blot-NBP1-80959-img0004.jpg)
Western Blot: PSMC1 Antibody [NBP1-80959] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells); Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).
![Immunocytochemistry/Immunofluorescence: PSMC1 Antibody [NBP1-80959] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/27952_PSMC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80959-img0003.jpg)
Immunocytochemistry/Immunofluorescence: PSMC1 Antibody [NBP1-80959] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/27953_PSMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-80959-img0001.jpg)
Immunohistochemistry-Paraffin: PSMC1 Antibody [NBP1-80959] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.
![Western Blot: PSMC1 Antibody [NBP1-80959] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: A-431 | Lane 5: Liver | Lane 6: Tonsil](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/27954_PSMC1-Antibody-Western-Blot-NBP1-80959-img0002.jpg)
Western Blot: PSMC1 Antibody [NBP1-80959] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: A-431 | Lane 5: Liver | Lane 6: Tonsil