RPL27 Antibody
| Name | RPL27 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82856 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GKVVLVLAGRYSGRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RPL27 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RPL27 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RPL27 Antibody [NBP1-82856] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29240_RPL27-Antibody-Western-Blot-NBP1-82856-img0002.jpg)
Western Blot: RPL27 Antibody [NBP1-82856] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunocytochemistry/Immunofluorescence: RPL27 Antibody [NBP1-82856] - Staining of human cell line U-251MG shows positivity in nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29241_RPL27-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82856-img0004.jpg)
Immunocytochemistry/Immunofluorescence: RPL27 Antibody [NBP1-82856] - Staining of human cell line U-251MG shows positivity in nucleoli.
![Immunohistochemistry-Paraffin: RPL27 Antibody [NBP1-82856] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29242_RPL27-Antibody-Immunohistochemistry-Paraffin-NBP1-82856-img0001.jpg)
Immunohistochemistry-Paraffin: RPL27 Antibody [NBP1-82856] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
![Western Blot: RPL27 Antibody [NBP1-82856] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/29243_RPL27%2520Antibody-Western%2520Blot-NBP1-82856-img0005.jpg)
Western Blot: RPL27 Antibody [NBP1-82856] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp