BRD9 Antibody
| Name | BRD9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82256 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLSSKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYS |
| Description | Rabbit Polyclonal |
| Gene | BRD9 |
| Supplier Page | Shop |
Product images
![Western Blot: BRD9 Antibody [NBP1-82256] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423141)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28018_BRD9-Antibody-Western-Blot-NBP1-82256-img0006.jpg)
Western Blot: BRD9 Antibody [NBP1-82256] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY423141)
![Immunocytochemistry/Immunofluorescence: BRD9 Antibody [NBP1-82256] - Staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28019_BRD9-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82256-img0004.jpg)
Immunocytochemistry/Immunofluorescence: BRD9 Antibody [NBP1-82256] - Staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.
![Immunohistochemistry-Paraffin: BRD9 Antibody [NBP1-82256] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28020_BRD9-Antibody-Immunohistochemistry-Paraffin-NBP1-82256-img0002.jpg)
Immunohistochemistry-Paraffin: BRD9 Antibody [NBP1-82256] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.