MTHFD1 Antibody
| Name | MTHFD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82610 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AANNLVAAAIDARIFHELTQTDKALFNRLVPSVNGVRRFSDIQIRRLKRLGIEKTDPTTLTDEEINRFARLDIDPETITWQRVLDTNDRFLRKITIGQAPTEKGHTRTAQFDISVASEIMAVLALTTSLEDMRERLGKMVVASSK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MTHFD1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MTHFD1 |
| Supplier Page | Shop |
Product images
![Western Blot: MTHFD1 Antibody [NBP1-82610] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28043_MTHFD1-Antibody-Western-Blot-NBP1-82610-img0003.jpg)
Western Blot: MTHFD1 Antibody [NBP1-82610] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
![Immunocytochemistry/Immunofluorescence: MTHFD1 Antibody [NBP1-82610] - Staining of human cell line A-431 shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28044_MTHFD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82610-img0004.jpg)
Immunocytochemistry/Immunofluorescence: MTHFD1 Antibody [NBP1-82610] - Staining of human cell line A-431 shows positivity in cytoplasm.
![Immunohistochemistry-Paraffin: MTHFD1 Antibody [NBP1-82610] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28045_MTHFD1-Antibody-Immunohistochemistry-Paraffin-NBP1-82610-img0001.jpg)
Immunohistochemistry-Paraffin: MTHFD1 Antibody [NBP1-82610] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
![Western Blot: MTHFD1 Antibody [NBP1-82610] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28046_MTHFD1%2520Antibody-Western%2520Blot-NBP1-82610-img0005.jpg)
Western Blot: MTHFD1 Antibody [NBP1-82610] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
![Western Blot: MTHFD1 Antibody [NBP1-82610] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28047_MTHFD1-Antibody-Western-Blot-NBP1-82610-img0002.jpg)
Western Blot: MTHFD1 Antibody [NBP1-82610] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 | Lane 2: RT-4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil