CYP2S1 Antibody
| Name | CYP2S1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32697 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YEDKEFQAVVRAAGGTLLGVSSQGGQTYEMFSWFLRPLPGPHKQLLHHVSTLAAFTVRQVQQHQGNLDASG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CYP2S1 Protein |
| Description | Rabbit Polyclonal |
| Gene | CYP2S1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CYP2S1 Antibody [NBP2-32697] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28231_CYP2S1-Antibody-Immunohistochemistry-NBP2-32697-img0005.jpg)
Immunohistochemistry: CYP2S1 Antibody [NBP2-32697] - liver cancer
![Immunohistochemistry: CYP2S1 Antibody [NBP2-32697] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28233_CYP2S1-Antibody-Immunohistochemistry-NBP2-32697-img0001.jpg)
Immunohistochemistry: CYP2S1 Antibody [NBP2-32697] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
![Immunohistochemistry: CYP2S1 Antibody [NBP2-32697] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28235_CYP2S1-Antibody-Immunohistochemistry-NBP2-32697-img0004.jpg)
Immunohistochemistry: CYP2S1 Antibody [NBP2-32697] - liver
![Western Blot: CYP2S1 Antibody [NBP2-32697] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410796)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/26049_CYP2S1-Antibody-Western-Blot-NBP2-32697-img0007.jpg)
Western Blot: CYP2S1 Antibody [NBP2-32697] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410796)