FAM76B Antibody
| Name | FAM76B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32670 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: HHRHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM76B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM76B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM76B Antibody [NBP2-32670] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-206](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15229_FAM76B-Antibody-Western-Blot-NBP2-32670-img0005.jpg)
Western Blot: FAM76B Antibody [NBP2-32670] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-206
![Immunocytochemistry/Immunofluorescence: FAM76B Antibody [NBP2-32670] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & nuclear membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15230_FAM76B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32670-img0007.jpg)
Immunocytochemistry/Immunofluorescence: FAM76B Antibody [NBP2-32670] - Staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & nuclear membrane.
![Immunohistochemistry-Paraffin: FAM76B Antibody [NBP2-32670] - Staining of human tonsil shows nuclear positivity in germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15231_FAM76B-Antibody-Immunohistochemistry-Paraffin-NBP2-32670-img0008.jpg)
Immunohistochemistry-Paraffin: FAM76B Antibody [NBP2-32670] - Staining of human tonsil shows nuclear positivity in germinal center cells.