Homez Antibody
| Name | Homez Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32661 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SSSFQVLANGATAASKPLQPLGCVPQSVSPSEQALPPHLEPAWPQGLRHNSVPGRVGPTEYLSPDMQRQRKTKRK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Homez Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | HOMEZ |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Homez Antibody [NBP2-32661] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10064_Homez%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32661-img0007.jpg)
Immunocytochemistry/Immunofluorescence: Homez Antibody [NBP2-32661] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
![Immunohistochemistry: Homez Antibody [NBP2-32661] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10065_Homez-Antibody-Immunohistochemistry-NBP2-32661-img0002.jpg)
Immunohistochemistry: Homez Antibody [NBP2-32661] - Staining of human testis shows strong nuclear positivity in subset of cells in seminiferus ducts.