GLYATL2 Antibody
| Name | GLYATL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32526 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKEGNFSNMFLDASHAGLVNEHW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GLYATL2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GLYATL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GLYATL2 Antibody [NBP2-32526] - Analysis of GLYATL2 in human melanoma using anti-GLYATL2 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4882_GLYATL2-Antibody-Western-Blot-NBP2-32526-img0007.jpg)
Western Blot: GLYATL2 Antibody [NBP2-32526] - Analysis of GLYATL2 in human melanoma using anti-GLYATL2 antibody. Image from verified customer review.
![Immunohistochemistry-Paraffin: GLYATL2 Antibody [NBP2-32526] - Staining of human salivary gland shows strong cytoplasmic positivity in basal cells in salivary ducts and acini.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4883_GLYATL2-Antibody-Immunohistochemistry-Paraffin-NBP2-32526-img0008.jpg)
Immunohistochemistry-Paraffin: GLYATL2 Antibody [NBP2-32526] - Staining of human salivary gland shows strong cytoplasmic positivity in basal cells in salivary ducts and acini.