PLEKHA3 Antibody
| Name | PLEKHA3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32018 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PLEKHA3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PLEKHA3 |
| Supplier Page | Shop |
Product images
![Western Blot: PLEKHA3 Antibody [NBP2-32018] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28335_PLEKHA3-Antibody-Western-Blot-NBP2-32018-img0009.jpg)
Western Blot: PLEKHA3 Antibody [NBP2-32018] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: PLEKHA3 Antibody [NBP2-32018] - Immunofluorescent staining of human cell line U-251 MG shows positivity in golgi apparatus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28336_PLEKHA3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32018-img0001.jpg)
Immunocytochemistry/Immunofluorescence: PLEKHA3 Antibody [NBP2-32018] - Immunofluorescent staining of human cell line U-251 MG shows positivity in golgi apparatus.
![Immunohistochemistry: PLEKHA3 Antibody [NBP2-32018] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28337_PLEKHA3-Antibody-Immunohistochemistry-NBP2-32018-img0007.jpg)
Immunohistochemistry: PLEKHA3 Antibody [NBP2-32018] - liver cancer
![Immunohistochemistry: PLEKHA3 Antibody [NBP2-32018] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28338_PLEKHA3-Antibody-Immunohistochemistry-NBP2-32018-img0002.jpg)
Immunohistochemistry: PLEKHA3 Antibody [NBP2-32018] - Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
![Immunohistochemistry: PLEKHA3 Antibody [NBP2-32018] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28339_PLEKHA3-Antibody-Immunohistochemistry-NBP2-32018-img0006.jpg)
Immunohistochemistry: PLEKHA3 Antibody [NBP2-32018] - liver