RCN2 Antibody
| Name | RCN2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-32011 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VTWDEYNIQMYDRVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHPEEVDYMTEF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RCN2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RCN2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32011] - Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28340_RCN2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32011-img0004.jpg)
Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32011] - Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.
![Immunohistochemistry: RCN2 Antibody [NBP2-32011] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28341_RCN2-Antibody-Immunohistochemistry-NBP2-32011-img0005.jpg)
Immunohistochemistry: RCN2 Antibody [NBP2-32011] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
![Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32011] - Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28342_RCN2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32011-img0001.jpg)
Immunocytochemistry/Immunofluorescence: RCN2 Antibody [NBP2-32011] - Immunofluorescent staining of human cell line U-2 OS shows positivity in endoplasmic reticulum.
![Immunohistochemistry: RCN2 Antibody [NBP2-32011] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28343_RCN2-Antibody-Immunohistochemistry-NBP2-32011-img0002.jpg)
Immunohistochemistry: RCN2 Antibody [NBP2-32011] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
![Immunohistochemistry: RCN2 Antibody [NBP2-32011] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28344_RCN2-Antibody-Immunohistochemistry-NBP2-32011-img0003.jpg)
Immunohistochemistry: RCN2 Antibody [NBP2-32011] - liver
![Immunohistochemistry: RCN2 Antibody [NBP2-32011] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28345_RCN2%2520Antibody-Immunohistochemistry-NBP2-32011-img0006.jpg)
Immunohistochemistry: RCN2 Antibody [NBP2-32011] - liver