KBTBD6 Antibody
| Name | KBTBD6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31882 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: TGPEELKDTAHSAALLAQLKSFYDARLLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KBTBD6 Protein |
| Description | Rabbit Polyclonal |
| Gene | KBTBD6 |
| Supplier Page | Shop |
Product images
![Western Blot: KBTBD6 Antibody [NBP2-31882] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28404_KBTBD6%2520Antibody-Western%2520Blot-NBP2-31882-img0008.jpg)
Western Blot: KBTBD6 Antibody [NBP2-31882] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
![Immunohistochemistry: KBTBD6 Antibody [NBP2-31882] - lymphoma](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28405_KBTBD6-Antibody-Immunohistochemistry-NBP2-31882-img0007.jpg)
Immunohistochemistry: KBTBD6 Antibody [NBP2-31882] - lymphoma
![Western Blot: KBTBD6 Antibody [NBP2-31882] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28406_KBTBD6-Antibody-Western-Blot-NBP2-31882-img0004.jpg)
Western Blot: KBTBD6 Antibody [NBP2-31882] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
![Immunohistochemistry: KBTBD6 Antibody [NBP2-31882] - Immunohistochemical staining of human tonsil shows strong membranous and cytoplasmic positivity in squamous epithelial cells along with strong positivity in germinal center cells and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28407_KBTBD6-Antibody-Immunohistochemistry-NBP2-31882-img0003.jpg)
Immunohistochemistry: KBTBD6 Antibody [NBP2-31882] - Immunohistochemical staining of human tonsil shows strong membranous and cytoplasmic positivity in squamous epithelial cells along with strong positivity in germinal center cells and non-germinal center cells.
![Immunohistochemistry: KBTBD6 Antibody [NBP2-31882] - Immunohistochemical staining of human tonsil shows strong membranous and cytoplasmic positivity in squamous epithelial cells along with strong positivity in germinal center cells and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28408_KBTBD6-Antibody-Immunohistochemistry-NBP2-31882-img0005.jpg)
Immunohistochemistry: KBTBD6 Antibody [NBP2-31882] - Immunohistochemical staining of human tonsil shows strong membranous and cytoplasmic positivity in squamous epithelial cells along with strong positivity in germinal center cells and non-germinal center cells.
![Immunohistochemistry: KBTBD6 Antibody [NBP2-31882] - skin](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/28409_KBTBD6-Antibody-Immunohistochemistry-NBP2-31882-img0006.jpg)
Immunohistochemistry: KBTBD6 Antibody [NBP2-31882] - skin