Aldolase C Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-90954
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVI
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: Aldolase C Protein
• Description: Rabbit Polyclonal
• Gene: ALDOC
• Conjugate: Unconjugated

Product images

Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: Aldolase C Antibody [NBP1-90954] - Staining of human cell line A-431 shows localization to nucleus, nucleoli fibrillar center & cytosol.

Immunohistochemistry-Paraffin: Aldolase C Antibody [NBP1-90954] - Staining of human hippocampus shows strong positivity in subsets of glial cells.

Western Blot: Aldolase C Antibody [NBP1-90954] - Analysis in human cerebral cortex tissue.