PIGP Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-84294
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTK
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: PIGP Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: PIGP
• Conjugate: Unconjugated

Product images

Western Blot: PIGP Antibody [NBP1-84294] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: PIGP Antibody [NBP1-84294] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.

Immunohistochemistry-Paraffin: PIGP Antibody [NBP1-84294] - Staining of human stomach shows strong membranous positivity in parietal cells.

Western Blot: PIGP Antibody [NBP1-84294] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).