DDX1 Antibody
| Name | DDX1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85294 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAEQTLNNIKQFKKY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DDX1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DDX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DDX1 Antibody [NBP1-85294] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-151](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22126_DDX1-Antibody-Western-Blot-NBP1-85294-img0007.jpg)
Western Blot: DDX1 Antibody [NBP1-85294] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-151
![Immunocytochemistry/Immunofluorescence: DDX1 Antibody [NBP1-85294] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22127_DDX1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85294-img0008.jpg)
Immunocytochemistry/Immunofluorescence: DDX1 Antibody [NBP1-85294] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22128_DDX1-Antibody-Immunohistochemistry-Paraffin-NBP1-85294-img0002.jpg)
Immunohistochemistry-Paraffin: DDX1 Antibody [NBP1-85294] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
![Western Blot: DDX1 Antibody [NBP1-85294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate ( Rat bladder tumor cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/22129_DDX1-Antibody-Western-Blot-NBP1-85294-img0005.jpg)
Western Blot: DDX1 Antibody [NBP1-85294] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate ( Rat bladder tumor cells).