FKBP11 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-84678
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:EAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGHKQVIPG
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: FKBP11 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: FKBP11
• Conjugate: Unconjugated

Product images

Western Blot: FKBP11 Antibody [NBP1-84678] - Western blot analysis in mouse liver tissue and rat liver tissue.

Immunocytochemistry/Immunofluorescence: FKBP11 Antibody [NBP1-84678] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.

Immunohistochemistry-Paraffin: FKBP11 Antibody [NBP1-84678] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine and endocrine pancreas.

Western Blot: FKBP11 Antibody [NBP1-84678] - Analysis in human cell line Daudi.