Acetyl CoA synthetase Antibody
| Name | Acetyl CoA synthetase Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90276 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Mouse |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Acetyl CoA synthetase Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ACSS2 |
| Supplier Page | Shop |
Product images
![Western Blot: Acetyl CoA synthetase Antibody [NBP1-90276] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/29108_Acetyl-CoA-synthetase-Antibody-Western-Blot-NBP1-90276-img0004.jpg)
Western Blot: Acetyl CoA synthetase Antibody [NBP1-90276] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
![Immunocytochemistry/Immunofluorescence: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/29109_Acetyl-CoA-synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90276-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli, cytoplasm & vesicles.
![Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human testis shows distinct cytoplasmic and nuclear positivity in leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/29110_Acetyl-CoA-synthetase-Antibody-Immunohistochemistry-Paraffin-NBP1-90276-img0001.jpg)
Immunohistochemistry-Paraffin: Acetyl CoA synthetase Antibody [NBP1-90276] - Staining of human testis shows distinct cytoplasmic and nuclear positivity in leydig cells.
![Western Blot: Acetyl CoA synthetase Antibody [NBP1-90276] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_1/29111_Acetyl%2520CoA%2520synthetase%2520Antibody-Western%2520Blot-NBP1-90276-img0005.jpg)
Western Blot: Acetyl CoA synthetase Antibody [NBP1-90276] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue