RBM11 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-92320
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:LYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSLP
• Purity/Format: Affinity purified
• Blocking Peptide: RBM11 Protein
• Description: Rabbit Polyclonal
• Gene: RBM11

Product images

Western Blot: RBM11 Antibody [NBP1-92320] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: RBM11 Antibody [NBP1-92320] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.

Immunohistochemistry-Paraffin: RBM11 Antibody [NBP1-92320] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.