Name | RHOBTB1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58908 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC IHC-P |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RHOBTB1(Rho-related BTB domain containing 1) The peptide sequence was selected from the middle region of RHOBTB1. Peptide sequence DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | RHOBTB1 |
Conjugate | Unconjugated |
Supplier Page | Shop |