RHOBTB1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-58908
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to RHOBTB1(Rho-related BTB domain containing 1) The peptide sequence was selected from the middle region of RHOBTB1. Peptide sequence DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: RHOBTB1
• Conjugate: Unconjugated

Product images

Western Blot: RHOBTB1 Antibody [NBP1-58908] - Sample Tissue: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 4.0ug/mL, Peptide Concentration: 2.0ug/mL, Lysate Quantity: 25ug/lane, Gel Concentration: 12%

Immunohistochemistry-Paraffin: RHOBTB1 Antibody [NBP1-58908] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.

Western Blot: RHOBTB1 Antibody [NBP1-58908] - Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate.