IGSF1 Antibody
| Name | IGSF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59109 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to IGSF1(immunoglobulin superfamily, member 1) The peptide sequence was selected from the N terminal of IGSF1 (NP_991402). Peptide sequence LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | IGSF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: IGSF1 Antibody [NBP1-59109] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14335_IGSF1-Antibody-Western-Blot-NBP1-59109-img0002.jpg)
Western Blot: IGSF1 Antibody [NBP1-59109] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml
![Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP1-59109] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14336_IGSF1-Antibody-Immunohistochemistry-Paraffin-NBP1-59109-img0003.jpg)
Immunohistochemistry-Paraffin: IGSF1 Antibody [NBP1-59109] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.