Claudin-17 Antibody
| Name | Claudin-17 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59155 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CLDN17 (claudin 17) The peptide sequence was selected from the middle region of CLDN17. Peptide sequence KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CLDN17 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Claudin 17 Antibody [NBP1-59155] - Titration: 2.0ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14500_Claudin%252017%2520Antibody-Western%2520Blot-NBP1-59155-img0004.jpg)
Western Blot: Claudin 17 Antibody [NBP1-59155] - Titration: 2.0ug/ml Positive Control: Jurkat cell lysate.
![Immunohistochemistry-Paraffin: Claudin 17 Antibody [NBP1-59155] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14501_Claudin%252017%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59155-img0001.jpg)
Immunohistochemistry-Paraffin: Claudin 17 Antibody [NBP1-59155] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
![Immunohistochemistry-Paraffin: Claudin 17 Antibody [NBP1-59155] - Human Spleen Tissue (cells indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14502_Claudin%252017%2520Antibody-Immunohistochemistry-Paraffin-NBP1-59155-img0003.jpg)
Immunohistochemistry-Paraffin: Claudin 17 Antibody [NBP1-59155] - Human Spleen Tissue (cells indicated with arrows), 4-8ug/ml.