HNRNPA0 Antibody

Name	HNRNPA0 Antibody
Supplier	Novus Biologicals
Catalog	NBP1-57275
Prices	$139.00, $299.00
Sizes	20 µl, 100 µl
Host	Rabbit
Clonality	Polyclonal
Applications	WB ICC/IF IHC IHC-P
Species Reactivities	Human
Antigen	Synthetic peptides corresponding to HNRPA0 (heterogeneous nuclear ribonucleoprotein A0) The peptide sequence was selected from the middle region of HNRPA0. Peptide sequence KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG.
Purity/Format	Protein A purified
Description	Rabbit Polyclonal
Gene	HNRNPA0
Conjugate	Unconjugated
Supplier Page	Shop

Product images

Western Blot: HNRNPA0 Antibody [NBP1-57275] - Amount and Lane 1 : 5% Input Lane 2: 5% Sup Lane 3: Normal IgG Lane 4: hn-RNPA0 ppt. k562 Sample IP Antibody: HNRPA0 Amount of IP Antibody: Primary Antibody: HNRPA0 Primary Antibody Dilution: 1 : 4000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody

Immunocytochemistry/Immunofluorescence: HNRNPA0 Antibody [NBP1-57275] - MCF7 cells Primary Antibody Dilution : 1:200 Secondary Antibody: Anti-rabbit-FITC Secondary Antibody Dilution: 1:500 Color/Signal Descriptions: DAPI: Blue hn-RNPA0: Green Gene Name: HNRPA0

Immunohistochemistry: HNRNPA0 Antibody [NBP1-57275] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Western Blot: HNRNPA0 Antibody [NBP1-57275] - Jurkat cell lysate, Antibody Titration: 0.625ug/ml

Western Blot: HNRNPA0 Antibody [NBP1-57275] - Lanes: Lane 1 : 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate Primary, Antibody Dilution: 1 : 4000 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: HNRPA0.

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.