PRDC/GREM2 Antibody

Name PRDC/GREM2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57598
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GREM2 (gremlin 2, cysteine knot superfamily, homolog (Xenopus laevis)) The peptide sequence was selected from the N terminal of GREM2)(50ug). Peptide sequence MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERW
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GREM2
Conjugate Unconjugated
Supplier Page Shop

Product images