ABCG5 Antibody

Name ABCG5 Antibody
Supplier Novus Biologicals
Catalog NBP1-59803
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ABCG5 (ATP-binding cassette, sub-family G (WHITE), member 5) The peptide sequence was selected from the middle region of ABCG5)(50ug). Peptide sequence CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ABCG5
Conjugate Unconjugated
Supplier Page Shop

Product images