DPCR-1 Antibody

Name DPCR-1 Antibody
Supplier Novus Biologicals
Catalog NBP1-60094
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DPCR1(diffuse panbronchiolitis critical region 1) The peptide sequence was selected from the C terminal of DPCR1. Peptide sequence SHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DPCR1
Conjugate Unconjugated
Supplier Page Shop

Product images