MRG15 Antibody
| Name | MRG15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57832 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MORF4L1 (mortality factor 4 like 1) The peptide sequence was selected from the middle region of MORF4L1. Peptide sequence YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | MORF4L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MRG15 Antibody [NBP1-57832] - HepG2 cell lysate, Antibody Titration: 5.0-10.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29953_MRG15-Antibody-Western-Blot-NBP1-57832-img0001.jpg)
Western Blot: MRG15 Antibody [NBP1-57832] - HepG2 cell lysate, Antibody Titration: 5.0-10.0ug/ml
![Immunohistochemistry-Paraffin: MRG15 Antibody [NBP1-57832] - Human urinary bladder tissue, Ganglionic cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29954_MRG15-Antibody-Immunohistochemistry-Paraffin-NBP1-57832-img0003.jpg)
Immunohistochemistry-Paraffin: MRG15 Antibody [NBP1-57832] - Human urinary bladder tissue, Ganglionic cells (Indicated with Arrows) 4-8ug/ml.
![Immunohistochemistry: MRG15 Antibody [NBP1-57832] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29955_MRG15%2520Antibody-Immunohistochemistry-NBP1-57832-img0004.jpg)
Immunohistochemistry: MRG15 Antibody [NBP1-57832] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
![Immunohistochemistry-Paraffin: MRG15 Antibody [NBP1-57832] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29956_MRG15-Antibody-Immunohistochemistry-Paraffin-NBP1-57832-img0002.jpg)
Immunohistochemistry-Paraffin: MRG15 Antibody [NBP1-57832] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.