CDT1 Antibody

Name CDT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58114
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB ICC/IF
Species Reactivities Human, Rat
Antigen Synthetic peptides corresponding to CDT1(chromatin licensing and DNA replication factor 1) The peptide sequence was selected from the C terminal of CDT1. Peptide sequence PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CDT1
Conjugate Unconjugated
Supplier Page Shop

Product images