CDYL Antibody
| Name | CDYL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-52986 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CDYL(chromodomain protein, Y-like) The peptide sequence was selected from the n terminal of CDYL. Peptide sequence YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CDYL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CDYL Antibody [NBP1-52986] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14346_CDYL-Antibody-Western-Blot-NBP1-52986-img0002.jpg)
Western Blot: CDYL Antibody [NBP1-52986] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: MD MB231, Primary Antibody Dilution: 4 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14347_CDYL-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-52986-img0004.jpg)
Immunocytochemistry/Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: MD MB231, Primary Antibody Dilution: 4 ug/ml
![Immunocytochemistry/Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14348_CDYL-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-52986-img0003.jpg)
Immunocytochemistry/Immunofluorescence: CDYL Antibody [NBP1-52986] - Sample Type: HeLa, Primary Antibody Dilution: 4 ug/ml